Search Products from 10 Million+
Range of ELISA Kits, Antibodies, Biochemicals, Recombinant Proteins & Assay Kits
Parathyroid Hormone (PTH) (3-34), human
Cat No:231-46 0.5MG | Brand:Echelon Biosciences
Description
| Pack Size | 0.5 mg |
|---|---|
| Storage Temperature | -20 degree C or below |
| Note | This product is for research use only. |
| Description | Molecular Weight: 3929.06 Salt Form: TFA Purity: >96% Sequence (3-letter): Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH Sequence (1-letter): SEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OH Storage: -20 °C or below Parathyroid Hormone (PTH) regulates serum calcium levels through its effects in the kidney, intestines, and bones. When serum calcium levels are low, PTH is secreted by the chief cells of the parathyroid gland, stimulating osteoclast activity and bone resorption thus the release of calcium. Measuring serum or plasma PTH levels is important for patients in chronic renal failure. Synthetic N-terminal truncated PTH peptides [e.g. PTH(2–34), PTH(3–34) and PTH(7–84)] do not cross‐react with the detection antibodies used in second‐generation PTH assays. |
Subscribe to our newsletter
Drop your email address to get regular updates about discounts and offers