Search Products from 10 Million+
Range of ELISA Kits, Antibodies, Biochemicals, Recombinant Proteins & Assay Kits
Prodynorphin 228-256 (porcine) (Dynorphin B 29, Leumorphin)
Cat No:274-56 1MG | Brand:Echelon Biosciences
Description
| Pack Size | 1 mg |
|---|---|
| Storage Temperature | -20 degree C or below |
| Note | This product is for research use only. |
| Description | Molecular Weight: 3525.73 Salt Form: TFA Purity: >96% Sequence (3-letter): Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr-Arg-Ser-Gln-Glu-Asp-Pro-Asn-Ala-Tyr-Tyr-Glu-Glu-Leu-Phe-Asp-Val-OH Sequence (1-letter): YGGFLRRQFKVVTRSQEDPNAYYEELFDV-OH Storage: -20 °C or below Leumorphin, porcine which corresponds to the 228-256 fragment of Preproenkephalin B. It is also known as Dynorphin B29 and Prodynorphin 228-256. Leumorphin is potent and selective κ-opioid receptor agonist. The porcine form of Leumorphin differs by 3 amino acids from the human form. |
Subscribe to our newsletter
Drop your email address to get regular updates about discounts and offers