Search Products from 10 Million+
Range of ELISA Kits, Antibodies, Biochemicals, Recombinant Proteins & Assay Kits
Description
| Pack Size | 0.5 mg |
|---|---|
| Storage Temperature | -20 degree C or below |
| Note | This product is for research use only. |
| Description | CAS Number: 159899-65-7 Molecular Weight: 3573.88 Salt Form: TFA Purity: >96% Sequence (3-letter): Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 Sequence (1-letter): TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 Storage: -20 °C or below Adrenomedullin (22-52) is an andrenomedullin (ADM) antagonist which blocks production of cAMP. In addition, it antagonizes the calcitonin generelated peptide (<b>CGRP</b>) receptor. |
Subscribe to our newsletter
Drop your email address to get regular updates about discounts and offers