Search Products from 10 Million+
Range of ELISA Kits, Antibodies, Biochemicals, Recombinant Proteins & Assay Kits
Description
| Pack Size | 1 mg |
|---|---|
| Storage Temperature | -20 degree C or below |
| Note | This product is for research use only. |
| Description | CAS Number: 137061-48-4 Molecular Weight: 4531.5 Salt Form: TFA Purity: >95% Sequence (3-letter): His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2 Sequence (1-letter): HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 Storage: -20 °C or below Pituitary adenylate cyclase-activating polypeptide (PACAP) stimulates adenylate cyclase and increases cAMP levels in cells. It is primarily expressed in nervous tissues and has high homology to vasoactive intestinal peptide (VIP). PACAP exists as 38- or 27-amino acid forms though the 1-38 form is predominant. PACAP binds to PAC1-R, VPAC1-R, and VPAC2-R receptors. PACAP functions as a neurotransmitter and neuromodulator. <strong>Publications</strong> <object id="wobj-318-350-37" style="width: 100%; height: 96px; background-color: [rgb color];" data="https://www.bioz.com/v_widget_2_5/318/350-37" type="text/html" width="300" height="150"></object> <div id="bioz-w-pb-350-37-div" style="width: 100%; display: none;"><a id="bioz-w-pb-350-37" style="font-size: 12px; text-decoration: none; color: transparent;" href="https://www.bioz.com/" target="_blank" rel="noopener noreferrer"><img style="width: 11px; height: 11px; vertical-align: baseline; padding-bottom: 0px; margin-left: 0px; margin-bottom: 0px; float: none; display: none;" src="https://cdn.bioz.com/assets/favicon.png" /> Powered by Bioz</a><a style="font-size: 12px; text-decoration: none; float: right; color: transparent;" href="https://www.bioz.com/result/350-37/product/Echelon Biosciences/?cn=350-37" target="_blank" rel="noopener noreferrer"> See more details on Bioz</a></div> |
Subscribe to our newsletter
Drop your email address to get regular updates about discounts and offers