Search Products from 10 Million+
Range of ELISA Kits, Antibodies, Biochemicals, Recombinant Proteins & Assay Kits
Corticotropin Releasing Factor (CRF), bovine
Cat No:353-26 0.5MG | Brand:Echelon Biosciences
Description
| Pack Size | 0.5 mg |
|---|---|
| Storage Temperature | -20 degree C or below |
| Note | This product is for research use only. |
| Description | CAS Number: 92307-52-3 Molecular Weight: 4697.34 Salt Form: TFA Purity: >95% Sequence (3-letter): Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Asn-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2 Sequence (1-letter): SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH2 Storage: -20 °C or below Corticotropin releasing factor (CRF) is a peptide hormone involved in the stress response that stimulates pituitary synthesis of ACTH, as part of the HPA Axis. |
Subscribe to our newsletter
Drop your email address to get regular updates about discounts and offers