Search Products from 10 Million+
Range of ELISA Kits, Antibodies, Biochemicals, Recombinant Proteins & Assay Kits
Description
Pack Size | 1 mg |
---|---|
Storage Temperature | -20 degree C or below |
Note | This product is for research use only. |
Description | Molecular Weight: 3926.89 Salt Form: TFA Purity: >95% Sequence (3-letter): His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Tyr-OH Sequence (1-letter): HADGSFSDEMNTILDNLAARDFINWLIQTKITDY-OH Storage: -20 °C or below Glucagon-like Peptide-2 (GLP-2) is a 33-amino acid peptide formed through post-translational proteolytic cleavage of proglucagon. GLP-2 produces a number of effects when administered to humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. This analog of GLP-2 with a C-terminal Tyr can be iodinated with <sup>125</sup>I and used as a tracer. |