Search Products from 10 Million+
Range of ELISA Kits, Antibodies, Biochemicals, Recombinant Proteins & Assay Kits
Description
| Pack Size | 0.5 mg |
|---|---|
| Storage Temperature | -20 degree C or below |
| Note | This product is for research use only. |
| Description | CAS Number: 9007-92-5, 16941-32-5 Molecular Weight: 3480.63 Salt Form: TFA Purity: >95% Sequence (3-letter): His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-OH Sequence (1-letter): HSQGTFTSDYSKYLDSRRAQDFVQWLMNT-OH Storage: -20 °C or below Solubility: 5 mg/ml in water Glucagon is a peptide hormone produced by the pancreas that opposes the action of insulin in peripheral tissues, predominantly the liver, where the insulin:glucagon ratio determines the intricate control of gluconeogenesis and glycogenolysis. The action of glucagon in the liver is complex and involves coordinate regulation of transcription factors and signal transduction networks which converge on regulation of amino acid, lipid and carbohydrate metabolism. It is also known to regulate the rate of glucose production, notably under conditions of insulin suppression, such as Diabetes mellitus. <h4>References</h4> 1.<a href="http://www.ncbi.nlm.nih.gov/pubmed/32119">Creutzfeldt W. The incretin concept today. Diabetologia. 1979 Feb;16(2):75–85. </a> 2.<a href="http://www.ncbi.nlm.nih.gov/pubmed/15494402"> Kimball, S.R. et al (2004) “Glucagon represses signaling through the mammalian target of rapamycin in rat liver by activating AMP-activated protein kinase” J. Biol. Chem. 279 (52): 54103-54109.</a> |
Subscribe to our newsletter
Drop your email address to get regular updates about discounts and offers