Search Products from 10 Million+
Range of ELISA Kits, Antibodies, Biochemicals, Recombinant Proteins & Assay Kits
Glucagon-like Peptide-1 (GLP-1) (7-37), human
Cat No:471-39 0.5MG | Brand:Echelon Biosciences
Description
| Pack Size | 0.5 mg |
|---|---|
| Storage Temperature | -20 degree C or below |
| Note | This product is for research use only. |
| Description | CAS Number: 106612-94-6 Molecular Weight: 3355.73 Salt Form: Acetate Purity: >96% Sequence (3-letter): His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH Sequence (1-letter): HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH Storage: -20 °C or below Glucagon-like Peptide-1 (7-37) is one the two primary biologically active forms of secreted glucagon-like peptide-1 (GLP-1). GLP-1 is secreted as a pro-pepetide that is then proteolytically cleaved into two active forms, (7-37) and (7-36). These active peptides can promote insulin secretion in a glucose-dependent manner. |
Subscribe to our newsletter
Drop your email address to get regular updates about discounts and offers