Search Products from 10 Million+
Range of ELISA Kits, Antibodies, Biochemicals, Recombinant Proteins & Assay Kits
Description
Pack Size | 1 mg |
---|---|
Storage Temperature | -20 degree C or below |
Note | This product is for research use only. |
Description | CAS Number: 83930-33-0 Molecular Weight: 4866.46 Salt Form: TFA Purity: >95% Sequence (3-letter): Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2 Sequence (1-letter): NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2 Storage: -20 °C or below Urotensin I, suckerfish, is related to mammalian urocortin and is involved in the regulation of cortisol and stress responses in teleost fish (e.g. suckerfish or white sucker). It releases ACTH from cultured mammalian cells by binding to CRF1 and CRF2 receptors. <b>Publication</b> <object id="wobj-318-817-30" style="width: 100%; height: 96px; background-color: [rgb color];" data="https://www.bioz.com/v_widget_2_5/318/817-30" type="text/html" width="300" height="150"></object> <div id="bioz-w-pb-817-30-div" style="width: 100%; display: none;"><a id="bioz-w-pb-817-30" style="font-size: 12px; text-decoration: none; color: transparent;" href="https://www.bioz.com/" target="_blank" rel="noopener noreferrer"><img style="width: 11px; height: 11px; vertical-align: baseline; padding-bottom: 0px; margin-left: 0px; margin-bottom: 0px; float: none; display: none;" src="https://cdn.bioz.com/assets/favicon.png" /> Powered by Bioz</a><a style="font-size: 12px; text-decoration: none; float: right; color: transparent;" href="https://www.bioz.com/result/817-30/product/Echelon Biosciences/?cn=817-30" target="_blank" rel="noopener noreferrer"> See more details on Bioz</a></div> |