Your Cart
Product
Product Title

2 x $5566
Total:$11132.00
SVG
SVG

Search Products from 10 Million+
Range of ELISA Kits, Antibodies, Biochemicals, Recombinant Proteins & Assay Kits

SVG

Urotensin I, suckerfish

Cat No:817-30 1MG | Brand:Echelon Biosciences

Share Item:

Quick Enquiry

Description

Pack Size 1 mg
Storage Temperature -20 degree C or below
Note This product is for research use only.
Description CAS Number: 83930-33-0 Molecular Weight: 4866.46 Salt Form: TFA Purity: &gt;95% Sequence (3-letter): Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2 Sequence (1-letter): NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2 Storage: -20 °C or below Urotensin I, suckerfish, is related to mammalian urocortin and is involved in the regulation of cortisol and stress responses in teleost fish (e.g. suckerfish or white sucker). It releases ACTH from cultured mammalian cells by binding to CRF1 and CRF2 receptors. <b>Publication</b> <object id="wobj-318-817-30" style="width: 100%; height: 96px; background-color: [rgb color];" data="https://www.bioz.com/v_widget_2_5/318/817-30" type="text/html" width="300" height="150"></object> <div id="bioz-w-pb-817-30-div" style="width: 100%; display: none;"><a id="bioz-w-pb-817-30" style="font-size: 12px; text-decoration: none; color: transparent;" href="https://www.bioz.com/" target="_blank" rel="noopener noreferrer"><img style="width: 11px; height: 11px; vertical-align: baseline; padding-bottom: 0px; margin-left: 0px; margin-bottom: 0px; float: none; display: none;" src="https://cdn.bioz.com/assets/favicon.png" /> Powered by Bioz</a><a style="font-size: 12px; text-decoration: none; float: right; color: transparent;" href="https://www.bioz.com/result/817-30/product/Echelon Biosciences/?cn=817-30" target="_blank" rel="noopener noreferrer"> See more details on Bioz</a></div>
SVG
SVG

Subscribe to our newsletter

Drop your email address to get regular updates about discounts and offers