Product Title

2 x $5566

Total:$11132.00

Back to shop

Proceed to Checkout

SVG

SVG

Search Products from 10 Million+

SVG

Galanin (1-29) (rat, mouse)

SKU: BTL-IB-P-00132 | Brand: Isca Biochemical

Quick Enquiry

Product Description

Cat Number	GA-030
Category	Peptide
Pack Size	1 mg
Description	Galanin receptor agonist
Modification	C-terminal amide
Purity	>95% by hplc
Biomarker Target	Galanin receptors
Sequence Three Letter Code	H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2
Molecular Formula	C141H211N43O41
Sl Sequence	GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2
Solubility	Soluble to 1 mg/ml in water
Appearance	Freeze dried solid
Storage	Store dry, frozen and in the dark
References	Fisone et al (1989) Galanin receptor and its ligands in the rat hippocampus. Eur J Biochem. 181(1) 269 PMID: 2469577Mazarati et al (2006) Regulation of kindling epileptogenesis by hippocampal galanin type 1 and type 2 receptors: The effects of subtype-selective agonists and the role of G-protein-mediated signaling. J Pharmacol Exp Ther. 318(2) 700 PMID: 16699066Serebryakova et al (2019) Galanin and its N-terminal fragments reduce acute myocardial infarction in rats. Peptides 111 127 PMID: 29730241 Related areas_x000D_ All peptides >All galanin receptor modulators >All neuroscience research categories >All appetite regulation research categories >All endocrinology research categories >
Note	The product is for research use only

SVG

SVG

Subscribe to our newsletter

Drop your email address to get regular updates about discounts and offers