Search Products from 10 Million+
Range of ELISA Kits, Antibodies, Biochemicals, Recombinant Proteins & Assay Kits
Gastrin Releasing Peptide (GRP), human
Cat No:471-85 0.5MG | Brand:Echelon Biosciences
Description
| Category | Peptide |
|---|---|
| Description | CAS Number: 93755-85-2 Molecular Weight: 2857.52 Salt Form: TFA Purity: >96% Sequence (3-letter): Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2 Sequence (1-letter): VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2 Storage: -20 °C or below Gastrin Releasing Peptide, human, is a ligand for the GRP receptor and is expressed in a subtype of peptidergic dorsal root ganglion neurons. GRP stimulates pepsinogen release and has also been identified as a tumor marker in the diagnosis of small-cell lung carcinoma. GRP is the mammalian analog of Bombesin. |
| Storage Tempreature | -20 degree C or below |
| Note | This product is for research use only. |
Subscribe to our newsletter
Drop your email address to get regular updates about discounts and offers