Search Products from 10 Million+
Range of ELISA Kits, Antibodies, Biochemicals, Recombinant Proteins & Assay Kits
Vasoactive Intestinal Peptide [Lys1, Pro2, 5, Arg3, 4, Tyr6] / VIP Antagonist
Cat No:491-32 0.5MG | Brand:Echelon Biosciences
Description
| Category | Peptide |
|---|---|
| Description | CAS Number: 125093-93-8 Molecular Weight: 3467.12 Salt Form: TFA Purity: >96% Sequence (3-letter): Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2 Sequence (1-letter): KPRRPYTDNYTRLRKQMAVKKYLNSILN-NH2 Storage: -20 °C or below Vasoactive Intestinal Peptide (VIP) is a peptide hormone which has several roles in both the body and the brain. VIP induces smooth muscle relaxation, stimulates water secretion, and inhibits gastric juice secretion in the digestive system. VIP plays a key role as a synchronizing agent in the suprachiasmatic nuclei (SCN) which controls the circadian rhythm. The Lys1, Pro2, 5, Arg3, 4, Tyr6 analog is a potent VIP antagonist. |
| Storage Tempreature | -20 degree C or below |
| Note | This product is for research use only. |
Subscribe to our newsletter
Drop your email address to get regular updates about discounts and offers