Product Description
| Cat Number | AB-010 |
|---|---|
| Category | Peptide |
| Pack Size | 0.1 mg |
| Description | Antimicrobial, the 63 amino acid sequence of the short form of thymic stromal lymphopoietin (sfTSLP) |
| Modification | None |
| Purity | >95% by hplc |
| Biomarker Target | Antibacterials |
| Sequence Three Letter Code | H-Met-Phe-Ala-Met-Lys-Thr-Lys-Ala-Ala-Leu-Ala-Ile-Trp-Cys-Pro-Gly-Tyr-Ser-Glu-Thr-Gln-Ile-Asn-Ala-Thr-Gln-Ala-Met-Lys-Lys-Arg-Arg-Lys-Arg-Lys-Val-Thr-Thr-Asn-Lys-Cys-Leu-Glu-Gln-Val-Ser-Gln-Leu-Gln-Gly-Leu-Trp-Arg-Arg-Phe-Asn-Arg-Pro-Leu-Leu-Lys-Gln-Gln-OH |
| Molecular Formula | C327H543N101O86S5 |
| Sl Sequence | MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| References |
Bjerkan et al (2015) The short form of TSLP is constitutively translated in human keratinocytes and has characteristics of an antimicrobial peptide. Mucosal Immunol 8 49 PMID: 24850429 Related areasAll antimicrobial peptides >All immunology research categories > |
| Note | The product is for research use only |
Share Item: