Product Description
| Cat Number | AM-080 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Broad spectrum insect antimicrobial |
| Modification | C terminal amide |
| Purity | >95% by HPLC |
| Biomarker Target | Antibacterials,Antifungals |
| Sequence Three Letter Code | H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2 |
| Molecular Formula | C184H313N53O46 |
| Sl Sequence | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2 |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store desiccated, frozen and in the dark |
| References |
Kulagina et al (2007) Antimicrobial peptides as new recognition molecules for screening challenging species. Sens. Actuators B Chem. 121(1) 150 PMID: 18231571Yu et al (2016) Combination Effects of Antimicrobial Peptides. Antimicrob. Agents and Chemother. 60 (3) 1717 PMID: 26729502 Related areas_x000D_ All antimicrobial peptides >All antifungal agents >All immunology research categories > |
| Note | The product is for research use only |
Share Item: