Product Description
| Cat Number | AM-081 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Broad spectrum insect antimicrobial peptide |
| Modification | C terminal amide |
| Purity | >95% by HPLC |
| Biomarker Target | Antibacterials,Antifungals |
| Sequence Three Letter Code | H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2 |
| Molecular Formula | C176H302N52O41S |
| Sl Sequence | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2 |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store desiccated, frozen and in the dark |
| References |
Kulagina et al (2007) Antimicrobial peptides as new recognition molecules for screening challenging species. Sens. Actuators B Chem. 121(1) 150 PMID: 18231571Hu et al (2013) Broad activity against porcine bacterial pathogens displayed by two insect antimicrobial peptides moricin and cecropin B. Mol. Cells 35(2) 106 PMID: 23456332Yu et al (2016) Combination Effects of Antimicrobial Peptides. Antimicrob. Agents and Chemother. 60 (3) 1717 PMID: 26729502 Related areas_x000D_ All antimicrobial peptides >All antifungal agents >All immunology research categories > |
| Note | The product is for research use only |
Share Item: