Product Description
| Cat Number | AM-140 |
|---|---|
| Category | Peptide |
| Pack Size | 0.1 mg |
| Description | Antifungal plant defensin isolated from radish seeds |
| Modification | Disulphide bridges between cysteines 4-51, 15-36, 21-45 and 25-47 |
| Purity | >95% by HPLC |
| Biomarker Target | Antifungals,Plant science |
| Sequence Three Letter Code | PyroGlu-Lys-Leu-Cys-Gln-Arg-Pro-Ser-Gly-Thr-Trp-Ser-Gly-Val-Cys-Gly-Asn-Asn-Asn-Ala-Cys-Lys-Asn-Gln-Cys-Ile-Arg-Leu-Glu-Lys-Ala-Arg-His-Gly-Ser-Cys-Asn-Tyr-Val-Phe-Pro-Ala-His-Lys-Cys-Ile-Cys-Tyr-Phe-Pro-Cys-OH (disulphide bridges between cysteines 4-51, 15-36, 21-45 and 25-47) |
| Molecular Formula | C244H368N76O68S8 |
| Sl Sequence | PyroGlu-KLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store dark, frozen and desiccated |
| References |
Aerts et al (2007) The Antifungal Activity of RsAFP2, a Plant Defensin from Raphanus sativus, Involves the Induction of Reactive Oxygen Species in Candida albicans. J. Mol. Microbiol. Biotechnol. 13 243 PMID: 17827975Bergter et al (2008) In Vitro Activity of the Antifungal Plant Defensin RsAFP2 against Candida Isolates and Its In Vivo Efficacy in Prophylactic Murine Models of Candidiasis. Antimicrob. Agents Chemother. 52(12) 4522 PMID: 18824606Thevissen et al (2012), The plant defensin RsAFP2 induces cell wall stress, septin mislocalization and accumulation of ceramides in Candida albicans. Mol. Microbiol. 84 166 PMID: 22384976 Related areasAll antimicrobial peptides >All antifungal agents >All immunology research areas >All plant science products > |
| Note | The product is for research use only |
Share Item: