Product Description
| Cat Number | AM-180 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | The host defence peptide LL 37 with an additional N-terminal cysteine |
| Modification | None |
| Purity | >95% by HPLC |
| Biomarker Target | Antibacterials |
| Sequence Three Letter Code | H-Cys-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH |
| Molecular Formula | C208H345N61O54S1 |
| Sl Sequence | CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Solubility | Soluble in water |
| Appearance | Freeze dried solid |
| Storage | Store cold, dark and desiccated |
| References |
Gabriel et al (2006) Preparation of LL-37-Grafted Titanium Surfaces with Bactericidal Activity. Bioconjugate Chem. 17(2) 548 PMID: 16536489 Related areasAll antimicrobial peptides >All immunology research categories > |
| Note | The product is for research use only |
Share Item: