Product Description
| Cat Number | AS-010 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Blocks ASIC1a binding to RIPK1 |
| Modification | None |
| Purity | >95% by hplc |
| Biomarker Target | Protein-protein interactions,Kinases,Acid sensing ion channels |
| Sequence Three Letter Code | H-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Cys-Met-Glu-Leu-Lys-Thr-Glu-Glu-Glu-Glu-Val-Gly-Gly-Val-Gln-Pro-Val-Ser-Ile-Gln-Ala-OH |
| Molecular Formula | C150H265N55O47S2 |
| Sl Sequence | GRKKRRQRRRCMELKTEEEEVGGVQPVSIQA |
| Solubility | Soluble in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| References |
Wang et al (2020) Disruption of auto-inhibition underlies conformational signaling of ASIC1a to induce neuronal necroptosis. Nat Commun. 11(1) 475 PMID: 31980622 Related areasAll cell penetrating peptides >All acid sensing ion channels >All protein-protein interaction modulators >All kinase modulators >All neuroscience categories > |
| Note | The product is for research use only |
Share Item: