Product Description
| Cat Number | CV-060 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Defensin like peptide with potent antiviral activity |
| Modification | None |
| Purity | >95% by HPLC |
| Biomarker Target | Antivirals |
| Sequence Three Letter Code | H-Asn-Gly-Ala-Ile-Cys-Trp-Gly-Pro-Cys-Pro-Thr-Ala-Phe-Arg-Gln-Ile-Gly-Asn-Cys-Gly-Arg-Phe-Arg-Val-Arg-Cys-Cys-Arg-Ile-Arg-OH |
| Molecular Formula | C144H232N52O35S5 |
| Sl Sequence | NGAICWGPCPTAFRQIGNCGRFRVRCCRIR |
| Solubility | Soluble to 5mg/ml in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| References |
Zhao et al (2020) A broad-spectrum virus- and host-targeting peptide against respiratory viruses including influenza virus and SARS-CoV-2. Nat Commun. 11 4252 PMID: 32843628 Related areasAll antimicrobial peptides >All antiviral agents >All immunology categories > |
| Note | The product is for research use only |
Share Item: