Product Description
| Cat Number | GH-008 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Glucagon like peptide 1 (GLP-1) receptor antagonist |
| Modification | C terminal amide |
| Purity | >95% by HPLC |
| Biomarker Target | Glucagon and related receptors |
| Sequence Three Letter Code | H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
| Molecular Formula | C176H272N46O58S |
| Sl Sequence | EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store desiccated, frozen and in the dark |
| References |
Lopez de Maturana et al. J. Biol. Chem. The Isolated N-terminal Domain of the Glucagon-like Peptide-1 (GLP-1) Receptor Binds Exendin Peptides with Much Higher Affinity than GLP-1(2003) 278 PMID: 12524435Liao et al (2015) In Vitro Metabolic Stability of Exendin-4: Pharmacokinetics and Identification of Cleavage Products. PLoS ONE 10(2) e0116805 PMID: 25723538 Related areas_x000D_ All peptides >All glucagon and related receptor modulators >All endocrinology research categories >All diabetes research categories > |
| Note | The product is for research use only |
Share Item: