Product Description
| Cat Number | GH-009 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Glucagon like peptide 1 (GLP-1) receptor antagonist |
| Modification | C terminal amide |
| Purity | >95% by HPLC |
| Biomarker Target | Glucagon and related receptors |
| Sequence Three Letter Code | H-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
| Molecular Formula | C169H262N44O54S |
| Sl Sequence | TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store desiccated, frozen and in the dark |
| References |
Kobayashi et al (2013) Exendin (5-39), an antagonist of GLP-1 receptor, modulates synaptic transmission via glutamate uptake in the dentate gyrus. Brain Res. 1505 1 PMID: 23318256Liao et al (2015) In Vitro Metabolic Stability of Exendin-4: Pharmacokinetics and Identification of Cleavage Products. PLoS ONE 10(2) e0116805 PMID: 25723538 Related areas_x000D_ All peptides >All glucagon and related receptor modulators >All endocrinology research categories >All diabetes research categories >All neuroscience research categories > |
| Note | The product is for research use only |
Share Item: