Product Description
| Cat Number | GH-060 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Endogenous neuropeptide Y receptor agonist |
| Modification | C terminal amide |
| Purity | >95% by HPLC |
| Biomarker Target | Neuropeptide Y receptors |
| Sequence Three Letter Code | H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 |
| Molecular Formula | C189H285N55O57S |
| Sl Sequence | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store in the dark, frozen and desiccated |
| References |
Michel et al (1998) XVI. International Union of Pharmacology recommendations for the nomenclature of neuropeptide Y, peptide YY, and pancreatic polypeptide receptors. Pharmacol.Rev. 50 143 PMID: 9549761Morales-Medina et al (2010) A possible role of neuropeptide Y in depression and stress. Brain Res. 1314 194 PMID: 19782662Holzer et al (2012) Neuropeptide Y, peptide YY and pancreatic polypeptide in the gut-brain axis. Neuropeptides 2012 46(6) 261 PMID: 22979996 Related areas All peptides >All neuropeptide Y receptor modulators >All neuroscience research categories >All appetite regulation research categories >All cardiovascular research categories > |
| Note | The product is for research use only |
Share Item: