Product Description
| Cat Number | GH-070 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Endogenous glucagon like peptide receptor agonist |
| Modification | None |
| Purity | >95% by HPLC |
| Biomarker Target | Glucagon and related receptors |
| Sequence Three Letter Code | H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala-OH |
| Molecular Formula | C192H295N59O60S |
| Sl Sequence | HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store dry, dark and frozen |
| References |
Bataille et al (1981) Bioactive enteroglucagon (oxyntomodulin): present knowledge on its chemical structure and its biological activities. Peptides 2 41 PMID: 6283496Jarrousse et al (1985) Oxyntomodulin (glucagon-37) and its C-terminal octapeptide inhibit gastric acid secretion. FEBS Lett. 188(1) 81 PMID: 4018272 Related areas_x000D_ All peptides >All glucagon and related receptor modulators >All endocrinology research categories >All appetite regulation research categories > |
| Note | The product is for research use only |
Share Item: