Product Description
| Cat Number | GH-150 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Stimulates insulin release |
| Modification | None |
| Purity | >95% by HPLC |
| Biomarker Target | Glucagon and related receptors |
| Sequence Three Letter Code | H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH |
| Molecular Formula | C226H338N60O66S |
| Sl Sequence | YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store dessicated, dark and frozen |
| References |
Wheeler et al (1995) Functional expression of the rat pancreatic islet glucose-dependent Insotropic polypeptide receptor: ligand binding and intracellular signaling properties. Endocrinol. 136 4629 PMID: 7664683Meier et al (2002) Gastric inhibitory polypeptide: the neglected incretin revisited. Regul.Peptides 107 1 PMID: 12137960Hansen et al (2016) N€terminally and C€terminally truncated forms of glucose€dependent insulinotropic polypeptide are high€affinity competitive antagonists of the human GIP receptor. Br. J. Pharmacol. 173 826 PMID: 26572091 Related areas_x000D_ All peptides >All glucagon and related receptor modulators >All endocrinology research categories >All diabetes research categories > |
| Note | The product is for research use only |
Share Item: