Product Description
| Cat Number | GL-020 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Stimulates insulin secretion |
| Modification | None |
| Purity | >95% by hplc |
| Biomarker Target | Glucagon and related receptors |
| Sequence Three Letter Code | H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH |
| Molecular Formula | C225H342N60O66S |
| Sl Sequence | YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ |
| Solubility | Soluble in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| References |
Wolffbrandt et al (1986) The effects of porcine GIP on insulin secretion and glucose clearance in the pig. Horm Metab Res. 18(3) 159 PMID: 3516832Yamada et al (2006) Pancreatic and Extrapancreatic Effects of Gastric Inhibitory Polypeptide. Diabetes 55 (Supplement 2) S86 DOI: 10.2337/db06-S011Marks (2020) The early history of GIP 1969-2000: From enterogastrone to major metabolic hormone. Peptides 125 170276 PMID: 32081451 Related areas_x000D_ All peptides >All glucagon and related receptor modulators >All endocrinology research categories >All diabetes research categories > |
| Note | The product is for research use only |
Share Item: