Product Description
| Cat Number | GL-040 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Endogenous proatherosclerotic peptide hormone |
| Modification | None |
| Purity | >95% by hplc |
| Biomarker Target | Glucagon and related receptors |
| Sequence Three Letter Code | H-Glu-Lys-Lys-Glu-Gly-His-Phe-Ser-Ala-Leu-Pro-Ser-Leu-Pro-Val-Gly-Ser-His-Ala-Lys-Val-Ser-Ser-Pro-Gln-Pro-Arg-Gly-Pro-Arg-OH |
| Molecular Formula | C140H226N44O41 |
| Sl Sequence | EKKEGHFSALPSLPVGSHAKVSSPQPRGPR |
| Solubility | Soluble in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| References |
Masaki et al (2021) GIP_HUMAN[22-51] is a new proatherogenic peptide identified by native plasma peptidomics. Sci Rep 11 14470 https://doi.org/10.1038/s41598-021-93862-w Related dataAll peptides >All glucagon and related receptor modulators >All cardiovascular research categories >All immunology categories > |
| Note | The product is for research use only |
Share Item: