Product Description
| Cat Number | MC-020 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Endogenous melanocortin receptor 2 (MC2R) agonist |
| Modification | None |
| Purity | >95% by hplc |
| Biomarker Target | Melanocortin receptors |
| Sequence Three Letter Code | H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH |
| Molecular Formula | C207H308N56O58S |
| Sl Sequence | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
| Solubility | Soluble to 1 mg/ml in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| References |
Kapas et al (1996) Agonist and receptor binding properties of adrenocorticotropin peptides using the cloned mouse adrenocorticotropin receptor expressed in a stably transfected HeLa cell line. Endocrinology 137 3291 PMID: 8754753Ghaddhab et al (2017) From Bioinactive ACTH to ACTH Antagonist: The Clinical Perspective. Front Endocrinol (Lausanne) 8 17 PMID: 28228747Benjamins et al (2018) Melanocortin receptor subtypes are expressed on cells in the oligodendroglial lineage and signal ACTH protection. J Neurosci Res. 96(3) 427 PMID: 28877366 Related areasAll peptides >All melanocortin receptor modulators >All endocrinology research categories > |
| Note | The product is for research use only |
Share Item: