Product Description
| Cat Number | NR-200 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Cx26 interaction region mimetic |
| Modification | C terminal amide |
| Purity | >95% by hplc |
| Biomarker Target | Nuclear receptor modulators,Protein-protein interactions |
| Sequence Three Letter Code | H-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Arg-Tyr-Cys-Ser-Gly-Lys-Ser-Lys-Lys-Pro-Val-NH2 |
| Molecular Formula | C158H260N52O33S2 |
| Sl Sequence | RQIKIWFQNRRMKWKKRYCSGKSKKPV-NH2 |
| Solubility | Soluble in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| References |
Mulkearns-Hubert et al (2023) Targeting NANOG and FAK via Cx26-derived cell-penetrating peptides in triple-negative breast cancer. Mol Cancer Sep 13 Epub ahead of print. PMID: 37703580 Related areas All cell penetrating peptides >All protein-protein interaction modulators >All nuclear receptor modulators >All cancer research categories > |
| Note | The product is for research use only |
Share Item: