Product Description
| Cat Number | PH-010 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Parathyroid hormone receptor agonist |
| Modification | None |
| Purity | >95% |
| Biomarker Target | Parathyroid hormone receptors |
| Sequence Three Letter Code | H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH |
| Molecular Formula | C181H291N55O51S2 |
| Sl Sequence | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
| Solubility | Soluble to 0.40 mg/ml in water |
| Appearance | Freeze fried solid |
| Storage | Store in the dark, frozen and dessicated |
| References |
Dobnig and Turner (1997) The effects of programmed administration of human parathyroid hormone fragment (1-34) on bone histomorphometry and serum chemistry in rats. Endocrinology 138 4607 PMID: 9348185Manabe et al (2007) Human parathyroid hormone (1-34) accelerates natural fracture healing process in the femoral osteotomy model of cynomolgus monkeys. Bone 40 1475 PMID: 17369013Osagie-Clouard et al (2017) Parathyroid hormone 1-34 and skeletal anabolic action: The use of parathyroid hormone in bone formation. Bone Joint Res. 6(1) 14 PMID: 28062525 Related areas_x000D_ All peptides >All parathyroid hormone receptor modulators >All endocrinology research categories > |
| Note | The product is for research use only |
Share Item: