Product Description
| Cat Number | PP-290 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Disrupts TGF-β/TβR2 interaction |
| Modification | None |
| Purity | >95% by HPLC |
| Biomarker Target | Protein-protein interactions |
| Sequence Three Letter Code | H-Phe-Gln-Gly-Thr-Phe-Pro-Asp-Gly-Phe-Leu-Trp-Ala-Val-Gly-Ser-Ala-Ala-Tyr-Gln-Thr-Glu-Gly-Gly-Trp-Gln-Gln-His-Gly-Lys-Gly-OH |
| Molecular Formula | C149H203N39O43 |
| Sl Sequence | FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG |
| Solubility | Soluble in water to 1 mg/ml |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| References |
Yuan (2022) A Klotho-derived peptide protects against kidney fibrosis by targeting TGF-β signaling. Nat Commun. 13(1) 438 PMID: 35064106 Related areasAll peptides >All protein-protein interaction modulators >All immunology research areas > |
| Note | The product is for research use only |
Share Item: