Product Description
| Cat Number | PP-370 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | HuR-PARP1 interaction blocker |
| Modification | None |
| Purity | >95% by hplc |
| Biomarker Target | Protein-protein interactions |
| Sequence Three Letter Code | H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Ser-Pro-Met-Gly-Val-Asp-His-Met-Ser-Gly-Leu-Ser-Gly-Val-Asn-Val-Pro-Gly-Asn-Ala-Ser-Ser-Gly-OH |
| Molecular Formula | C151H257N59O46S2 |
| Sl Sequence | YGRKKRRQRRRSPMGVDHMSGLSGVNVPGNASSG |
| Solubility | Soluble in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| References |
Wang et al (2022) Cell-Penetrating Peptide TAT-HuR-HNS3 Suppresses Proinflammatory Gene Expression via Competitively Blocking Interaction of HuR with Its Partners. J Immunol. 208(10) 2376 PMID: 35444028 Related areasAll cell penetrating peptides >All protein-protein interaction modulators >All immunology research categories >All cancer research categories > |
| Note | The product is for research use only |
Share Item: