Your Cart
Product
Product Title

2 x $5566
Total:$11132.00
Proceed to Checkout
SVG
SVG

Search Products from 10 Million+

SVG

Rab5 Protein

SKU: BTL-SM-P-00027 | Brand: Stressmarq
Quick Enquiry

Product Description

Cat Number SPR-121A
Category Recombinant Protein
Pack Size 50 µg
Description Human Recombinant Rab5 Protein
Applications WB | SDS-PAGE
Target Rab5
Molecular Weight ~26 kDa
Cellular Localization Cell Membrane | Early Endosome Membrane | Melanosome
Purity >90%
Research Area Cancer | Heat Shock
Swiss Prot P20339
Scientific Background Rab5 is a 24kDa member of the Rab family of small guanosine triphosphatases (GTPases), Ras superfamily. Rab GTPases are central regulators of membrane trafficking in the eukaryotic cell. Their regulatory capacity depends on their ability to cycle between the GDP -bound inactive and GTP-bound active states. This conversion is regulated by GDP/GTP exchange factors (GEPs), GDP dissociation inhibitors (GDIs) and GTPase-activating proteins (GAPs) (1, 2). Activation of a Rab protein is coupled to its association with intracellular membranes, allowing it to recruit downstream effector proteins to the cytoplasmic surface of a subcellular compartment (3). Through these proteins, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion(1). Rab proteins contain conserved regions involved in guanine-nucleotide binding, and hyper variable COHO-terminal domains with a cysteine motif implicated in subcellular targeting. Post-translational modification of the cysteine motif with one or two geranyl groups is essential for the membrane association and correct intracellular localization of Rab proteins(3). Each Rab shows a characteristic subcellular distribution (4). In particular, Rab5 is ubiquitously expressed in human tissues. It localizes mainly to early endosomes, but is also present on the plasma membrane. It regulates the fusion between endocytic vesicles and early endosomes, as well as the homotypic fusion between early endosomes (5). Among the proteins recruited by the GTP-bound active Rab5 are Rabaptin-5 and EEA1 (6). Anti-Rab5 may be used as an early endosome marker.
Expression System E. coli
Accession Number BC001267
Gene Id 5868
Amino Acid Sequence MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
Purification Affinity Purified
Storage -20ºC
References 1. Stenmark H., and Olkkonen V.M. (2001) Genome Biol. 2: 3007.1-3007.7. 2. Takai Y., et al. (2001) Physiol. Rev. 8:, 153-208. 3. Ali B.R., et al. (2004) J. Cell Sci. 117: 6401-6412. 4. Zerial M., and McBride H. (2001) Nat. Rev. Mol. Cell Biol. 2: 107-117. 5. Sonnichsen B., et al. (2000) J. Cell Biol. 149: 901-913 6. Woodman P.G. (2000) Traffic. 1: 695-701.
Product Url View Document
Note The product is for research use only
SVG
SVG

Subscribe to our newsletter

Drop your email address to get regular updates about discounts and offers