Your Cart
Product
Product Title

2 x $5566
Total:$11132.00
Proceed to Checkout
SVG
SVG

Search Products from 10 Million+

SVG

p23 Protein

SKU: BTL-SM-P-00045 | Brand: Stressmarq
Quick Enquiry

Product Description

Cat Number SPR-303A
Category Recombinant Protein
Pack Size 50 µg
Description Human Recombinant p23 Protein
Applications WB | SDS-PAGE | Functional Assay
Target p23
Molecular Weight ~23 kDa
Cellular Localization Cytoplasm
Purity >90%
Research Area Cancer | Heat Shock
Swiss Prot Q15185
Scientific Background p23 is a highly conserved ubiquitous protein, known to have an important function as a cochaperone for the HSP90 chaperoning system (1). Studies have revealed that p23 is a small protein (18 to 25 kDa) with a simple structure (2, 3). p23 does not have any structural homology with any other known proteins (1). p23 was first discovered as a part of the HSP90-progesterone receptor complex along with HSP70, p54 and p50 (1). p23 is a phosphor-protein, which is highly acidic and has an aspartic acid-rich c-terminal domain (1). Numerous studies have found p23 to be associated with other client proteins like Fes tyrosine kinase (4), the heme regulated kinase HRI (5), hsf1 transcription factor (4), aryl hydrocarbon receptor (4), telomerase (6), and Hepadnavirus reverse transcriptase (7). In spite of several years of study, the exact functional significance of p23 is still not clear (8). p23 is thought to be involved in the adenosine triphosphate–mediated HSP90 binding of client proteins (8). Since many HSP90 client proteins are involved in oncogenic survival signaling, a recent study has concluded p23 to be a promising target in leukemic apoptosis (9). HSP90 and its co-chaperone p23 are certainly among the emerging anti-tumor targets in oncology.
Expression System E. coli
Accession Number NP_006592.3
Gene Id 10728
Amino Acid Sequence SHMQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
Purification Affinity Purified
Storage -20ºC
References 1. Johnson J.L., Beito T. G., Krco C.J. & Toft D.O. (1994) Mol Cell Biol. 14: 1956-63. 2. Weikl T., Abelmann K. & Buchner J. (1999) J Mol Biol. 293: 685-91. 3. Weaver A.J., Sullivan W.P., Felts S.J., Owen B.A. & Toft, D.O. (2000) J Biol Chem. 275: 23045-52. 4. Nair S.C., et al. (1996) Cell Stress Chaperones. 1: 237-50. 5. Xu Z., et al. (1997) Eur J Biochem. 246, 461-70. 6. Holt S.E., et al. (1999) Genes Dev. 13: 817-26. 7. Hu J., Toft D., Anselmo D. & Wang X. (2002) J Virol. 76: 269-79. 8. Felts S.J. & Toft D.O. (2003) Cell Stress Chaperones. 8: 108-13. 9. Gausdal G., Gjertsen B.T., Fladmark K.E., Demol H., Vandekerckhove J. & Doskeland S.O. (2004) Leukemia.
Product Url View Document
Note The product is for research use only
SVG
SVG

Subscribe to our newsletter

Drop your email address to get regular updates about discounts and offers