Product Description
| Cat Number | SPR-310B |
|---|---|
| Category | Recombinant Protein |
| Pack Size | 100 µg |
| Description | Human Recombinant Cpn10 Protein |
| Applications | WB | SDS-PAGE |
| Target | Cpn10 |
| Molecular Weight | ~10 kDa |
| Cellular Localization | Mitochondrion Matrix |
| Purity | >90% |
| Research Area | Cancer | Heat Shock |
| Swiss Prot | P61604 |
| Scientific Background | Chaperonin 10, otherwise known as Cpn10, (groES in E.coli) make up a family of small heart shock proteins with an approximate molecular mass of 10kDa (HSP10s). Cpn10 acts as a co-chaperone and interacts with the HSP60 family to promote proper folding of polypeptides. Cpn10 and Cpn60 both exhibit sevenfold axis of symmetry and function as a team in the protein folding and assembly process (1). Cpn10 has been located in human platelets, but is also present in human maternal serum (2, 3). It has been reported that human Cpn10 is identical with early pregnancy factor, which is involved in control over cell growth and development. This identification suggest that Cpn10 may act like a hormone in stressful situations such as pregnancy (4). |
| Expression System | E. coli |
| Accession Number | NM_002157.2 |
| Gene Id | 3336 |
| Amino Acid Sequence | MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD |
| Purification | Multi-Step Purified |
| Storage | -20ºC |
| References | 1. Velez-Granell C.S., et al. (1994) J of Cell Science. 107(3):539-549. 2. Morton H., Hegh V., and Clunie G.J.A. (1974) Nature (London) 249: 459-460. 3. Cavanagh A.C., and Morton H. (1994) Eur. J. Biochem. 222: 551-560. 4. Minto M., et al. (1998) Molecular Cell Research. 1403 (2): 151-157. |
| Product Url | View Document |
| Note | The product is for research use only |
Share Item: