Product Description
| Cat Number | SPR-314A |
|---|---|
| Category | Recombinant Protein |
| Pack Size | 50 µg |
| Description | Yeast Recombinant AHA1 Protein |
| Applications | WB | SDS-PAGE | Functional Assay |
| Target | AHA1 |
| Molecular Weight | ~405 kDa |
| Cellular Localization | Cytoplasm |
| Purity | >90% |
| Research Area | Cancer | Heat Shock | Cell Signaling | Protein Trafficking | Chaperone Proteins |
| Swiss Prot | Q12449 |
| Scientific Background | Aha1 is a member of the HSP90 cochaperone family, and is thought to stimulate HSP90 ATPase activity by competing with p23 and other co-chaperones for HSP90 binding (1, 2). It may affect a step in the endoplasmic reticulum to Golgi trafficking. Aha1 also interacts with HSPCA/HSP90 and with the cytoplasmic tail of the vesicular stomatistis virus glycoproteins (VSV G) (3). Aha1 is expressed in numerous tissues, including the brain, heart, skeletal muscle, and kidney, and at low levels, the liver and placenta. Aha1 might be a potential therapeutic strategy to increase sensitivity to HSP inhibitors (4). |
| Expression System | E. coli |
| Accession Number | NM_001180522.1 |
| Gene Id | 851800 |
| Amino Acid Sequence | MGHHHHHHMVVNNPNNWHWVDKNCIGWAKEYFKQKLVGVEAGSVKDKKYAKIKSVSSIEGDCEVNQRKGKVISLFDLKITVLIEGHVDSKDGSALPFEGSINVPEVAFDSEASSYQFDISIFKETSELSEAKPLIRSELLPKLRQIFQQFGKDLLATHGNDIQVPESQVKSNYTRGNQKSSFTEIKDSASKPKKNALPSSTSTSAPVSSTNKVPQNGSGNSTSIYLEPTFNVPSSELYETFLDKQRILAWTRSAQFFNSGPKLETKEKFELFGGNVISELVSCEKDKKLVFHWKLKDWSAPFNSTIEMTFHESQEFHETKLQVKWTGIPVGEEDRVRANFEEYYVRSIKLTFGFGAVL |
| Purification | Affinity Purified |
| Storage | -20ºC |
| References | 1. Hainzl O., Lapina M.C., Buchner J., Richter K. (2009) J Biol Chem. Epub. 2. Harst A., Lin H., Obermann W.M. (2005) Biochem J. 387 (pt.3): 789-796. 3. Lotz G.P., Brychzy A., Heinz S., Obermann W.M. (2008) J Cell Sci. 121(pt.5): 717-723. 4. Holmes J.L., Sharp S.Y., Hobbs S., Workman P. (2008) Cancer Res. 68(4): 1188-1197. |
| Product Url | View Document |
| Note | The product is for research use only |

Share Item: