Your Cart
Product
Product Title

2 x $5566
Total:$11132.00
Proceed to Checkout
SVG
SVG

Search Products from 10 Million+

SVG

Alpha Synuclein Pre-formed Fibrils: ATTO 594 (Type 1)

SKU: BTL-SM-P-00074 | Brand: Stressmarq
Quick Enquiry

Product Description

Cat Number SPR-322B-A594
Category Recombinant Protein
Pack Size 100 µg
Description Human Recombinant Alpha Synuclein Protein Pre-formed Fibrils: ATTO 594 (Type 1)
Applications WB | SDS-PAGE | In vivo assay | In vitro assay
Target Alpha Synuclein: ATTO 594
Molecular Weight N/A
Cellular Localization Cytoplasm | Membrane | Nucleus
Purity >95%
Research Area Neuroscience | Neurodegeneration | Alzheimer's Disease | Tangles & Tau | Neuroscience | Neurodegeneration | Parkinson's Disease | Synuclein | Neuroscience | Neurodegeneration | Multiple System Atrophy
Swiss Prot P37840
Scientific Background Alpha-Synuclein (SNCA) is expressed predominantly in the brain, where it is concentrated in presynaptic nerve terminals (1). Alpha-synuclein is highly expressed in the mitochondria of the olfactory bulb, hippocampus, striatum and thalamus (2). Functionally, it has been shown to significantly interact with tubulin (3), and may serve as a potential microtubule-associated protein. It has also been found to be essential for normal development of the cognitive functions; inactivation may lead to impaired spatial learning and working memory (4). SNCA fibrillar aggregates represent the major non A-beta component of Alzheimers disease amyloid plaque, and a major component of Lewy body inclusions, and Parkinson's disease. Parkinson's disease (PD) is a common neurodegenerative disorder characterized by the progressive accumulation in selected neurons of protein inclusions containing alpha-synuclein and ubiquitin (5, 6).
Expression System E. coli
Accession Number NP_000336.1
Gene Id 6622
Biological Activity Under Investigation
Protein Length Full Length
Amino Acid Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAG
Purification Ion-exchange Purified
Storage -80ºC
References 1. “Genetics Home Reference: SNCA”. US National Library of Medicine. (2013). 2. Zhang L., et al. (2008) Brain Res. 1244: 40-52. 3. Alim M.A., et al. (2002) J Biol Chem. 277(3): 2112-2117. 4. Kokhan V.S., Afanasyeva M.A., Van'kin G. (2012) Behav. Brain. Res. 231(1): 226-230. 5. Spillantini M.G., et al. (1997) Nature. 388(6645): 839-840. 6. Mezey E., et al. (1998) Nat Med. 4(7): 755-757.
Product Url View Document
Note The product is for research use only
SVG
SVG

Subscribe to our newsletter

Drop your email address to get regular updates about discounts and offers