Product Description
| Cat Number | SPR-476B |
|---|---|
| Category | Recombinant Protein |
| Pack Size | 100 µg |
| Description | Human Recombinant Tau (K18) Delta K280 Mutant Protein Monomers |
| Applications | WB | SDS-PAGE | In vivo assay | In vitro assay |
| Target | Tau (K18) Delta K280 Mutant |
| Molecular Weight | ~15 kDa |
| Cellular Localization | Cytoplasm | Axolemma | Axolemma Plasma Membrane | Axon | Cell Body | Cell membrane | Cytoplasmic Ribonucleoprotein Granule | Cytoplasmic Side | Cytoskeleton | Cytosol | Dendrite | Growth cone | Microtubule | Microtubule Associated Complex | Neurofibrillary Tangle | Neuronal Cell Body | Nuclear Periphery | Nuclear Speck | Nucleus | Peripheral membrane protein | Plasma Membrane | Tubulin Complex |
| Purity | >95% |
| Research Area | Alzheimer's Disease | Axon Markers | Cell Markers | Cell Signaling | Cytoskeleton | Microtubules | MT Associated Proteins | Neurodegeneration | Neuron Markers | Neuroscience | Tangles & Tau |
| Swiss Prot | P10636 |
| Scientific Background | Alzheimer’s Disease (AD) is the most common neurodegenerative disease, affecting 10% of seniors over the age of 65 (1). It was named after Alois Alzheimer, a German scientist who discovered tangled bundles of fibrils where neurons had once been in the brain of a deceased patient in 1907 (2). Tau (tubulin-associated unit) is normally located in the axons of neurons where it stabilizes microtubules. Tauopathies such as AD are characterized by neurofibrillary tangles containing hyperphosphorylated tau fibrils (3). The ΔK280 mutation is associated with frontotemporal dementia and promotes fibrillization into paired helical filaments (PHFs) in the absence of heparin and other inducers (4). K18 is a truncated form of human tau containing only the 4 microtubule binding repeats (5). |
| Expression System | E. coli |
| Gene Id | 4137 |
| Protein Length | Partial |
| Amino Acid Sequence | MSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE |
| Purification | Ion-exchange Purified |
| Storage | -80ºC |
| References | 1. www.alz.org/alzheimers-dementia/facts-figures 2. Alzheimer, A. Über eine eigenartige Erkrankung der Hirnrinde. Allg. Z. Psychiatr. Psych.-Gerichtl. Med. 64, 146–148 (1907) 3. Matsumoto, G. et al. (2018). Int J Mol Sci. 19, 1497. 4.Von Bergen, M. et al. (2001). J Biol Chem. 276(51):48165-48174. 5. Guo, J. and Lee, M.Y. (2013). FEBS Lett. 587(6): 717-723. |
| Product Url | View Document |
| Note | The product is for research use only |

Share Item: