Your Cart
Product
Product Title

2 x $5566
Total:$11132.00
Proceed to Checkout
SVG
SVG

Search Products from 10 Million+

SVG

Alpha Synuclein Pre-formed Fibrils

SKU: BTL-SM-P-00201 | Brand: Stressmarq
Quick Enquiry

Product Description

Cat Number SPR-482E
Category Recombinant Protein
Pack Size 100 µg x5
Description Rat Recombinant Alpha Synuclein Protein Pre-formed Fibrils
Applications WB | SDS-PAGE | In vivo assay | In vitro assay
Target Alpha Synuclein
Molecular Weight 14.515 kDa
Cellular Localization Cytoplasm | Membrane | Nucleus
Purity >95%
Research Area Neuroscience | Neurodegeneration | Alzheimer's Disease | Tangles & Tau | Neuroscience | Neurodegeneration | Parkinson's Disease | Synuclein | Neuroscience | Neurodegeneration | Multiple System Atrophy
Swiss Prot P37377
Scientific Background Alpha-Synuclein (SNCA) is expressed predominantly in the brain, where it is concentrated in presynaptic nerve terminals (1). Alpha-synuclein is highly expressed in the mitochondria of the olfactory bulb, hippocampus, striatum and thalamus (2). Functionally, it has been shown to significantly interact with tubulin (3), and may serve as a potential microtubule-associated protein. It has also been found to be essential for normal development of the cognitive functions; inactivation may lead to impaired spatial learning and working memory (4). SNCA fibrillar aggregates represent the major non A-beta component of Alzheimers disease amyloid plaque, and a major component of Lewy body inclusions, and Parkinson's disease. Parkinson's disease (PD) is a common neurodegenerative disorder characterized by the progressive accumulation in selected neurons of protein inclusions containing alpha-synuclein and ubiquitin (5, 6). The A53T mutation is a missense point mutation where alanine is replaced by threonine at the 53rd amino acid. This mutation has been linked to early-onset Parkinson's Disease and increased rates of alpha synuclein fibrillization.
Expression System E. coli
Accession Number NP_062042.1
Gene Id 29219
Protein Length Full Length
Amino Acid Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTK EQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDP SSEAYEMPSEEGYQDYEPEA
Purification Ion-exchange Purified
Storage -80ºC
References 1. “Genetics Home Reference: SNCA”. US National Library of Medicine. (2013). 2. Zhang L., et al. (2008) Brain Res. 1244: 40-52. 3. Alim M.A., et al. (2002) J Biol Chem. 277(3): 2112-2117. 4. Kokhan V.S., Afanasyeva M.A., Van'kin G. (2012) Behav. Brain. Res. 231(1): 226-230. 5. Spillantini M.G., et al. (1997) Nature. 388(6645): 839-840. 6. Mezey E., et al. (1998) Nat Med. 4(7): 755-757. 7. Polymeropoulos, M. H. (1998). Science. 276(5321), 2045–2047 8. Conway, K.E., et al. (1998). Nat Med. 4(11):1318-20
Product Url View Document
Note The product is for research use only
SVG
SVG

Subscribe to our newsletter

Drop your email address to get regular updates about discounts and offers