Amyloid Beta Pyroglutamate 3-42 Pre-formed Fibrils
SKU: BTL-SM-P-00221 |
Brand: Stressmarq
Product Description
| Cat Number | SPR-492B |
|---|---|
| Category | Recombinant Protein |
| Pack Size | 100 µg |
| Description | Human Amyloid Beta Pyroglutamate 3-42 Pre-formed Fibrils |
| Applications | WB | In vivo Assay | In vitro Assay |
| Target | Amyloid Beta Pyroglutamate 3-42 |
| Molecular Weight | 4.3 kDa |
| Cellular Localization | Cell Membrane | Intracellular Vesicles |
| Purity | >95% |
| Research Area | Neuroscience | Neurodegeneration | Alzheimer's Disease | Amyloid |
| Swiss Prot | P05067 |
| Scientific Background | Our Amyloid Beta pyroglutamate 3-42 (pyro Aβ) Pre-formed Fibrils are generated from Amyloid Beta Peptide 3-42 pre-treated with 1,1,1,3,3,3-Hexafluoro-2-propanol (HFIP) using a previously published method (1,2). Our pyro Aβ3-42 fibrils present as primarily long strands when observed under TEM and AFM, and have a unique high molecular weight signal on a Western Blot with an anti-amyloid beta antibody. Amyloid beta peptide (Aβ) is generated by protease cleavage of amyloid precursor protein (APP), which aggregates into oligomers, protofibrils, fibrils and ultimately plaques. The accumulation of Aβ plaques in the brain is considered a hallmark of Alzheimer’s disease (AD), and most of the drugs tested for AD in the past 20 years have targeted amyloid beta accumulation (3). Pyroglutamate Aβ 3-42 is an N-terminally truncated peptide species that is modified by glutaminyl cyclase and has been reported to compromise 15-45% of total amyloid beta deposits in brains of AD patients (4,5). Pyroglutamate Aβ 3-42 exhibits higher aggregation propensity and neurotoxicity compared with full-length Aβ 1-42 (6,7) and is an active target in the next generation AD therapeutic development (8). |
| Expression System | N/A |
| Gene Id | 351 |
| Protein Length | 40 amino acids |
| Amino Acid Sequence | pyroEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
| Purification | N/A |
| Storage | -80ºC |
| References | 1. Stine et al. 2003. JBC. 278(13):11612-22; doi: 10.1074/jbc.M210207200 2. Chromy et al. 2003. Biochemistry. 42:12749-12760; doi: 10.1021/bi030029q 3. Panza et al. 2019. Nat Rev Neurol. 15:73-88; https://doi.org/10.1038/s41582-018-0116-6 4. Valverde et al. 2021. JBC. 297:100963; https://doi.org/10.1016/j.jbc.2021.100963 5. Schilling et al. 2008. Nat Med. 14:1106-11; DOI: 10.1038/nm.1872 6. Hartlage-Rubsamen et al. 2011. Acta Neuropathol. 121:705-19; 10.1007/s00401-011-0806-2 7. Xu, Wang and Wu. 2021. J Med Chem. 64:6549–65; DOI: 10.1021/acs.jmedchem.1c00325 8. Bayer. 2021. Nat Mol Psych. 27:1880-1885; https://doi.org/10.1038/s41380-021-01409-3 |
| Product Url | View Document |
| Note | The product is for research use only |
Share Item: