Your Cart
Product
Product Title

2 x $5566
Total:$11132.00
Proceed to Checkout
SVG
SVG

Search Products from 10 Million+

SVG

Alpha Synuclein TNG (A53T, S87N, N103G) Mutant Monomers

SKU: BTL-SM-P-00255 | Brand: Stressmarq
Quick Enquiry

Product Description

Cat Number SPR-503XE
Category Recombinant Protein
Pack Size 500 µg (@5mg/ml)
Description Human Recombinant Alpha Synuclein TNG (A53T, S87N, N103G) Mutant Monomers
Applications WB | In vivo Assay | In vitro Assay
Target Alpha Synuclein TNG (A53T, S87N, N103G)
Molecular Weight 14.46 kDa
Purity >95%
Research Area Neuroscience | Neurodegeneration | Alzheimer's Disease | Tangles & Tau | Neuroscience | Neurodegeneration | Parkinson's Disease | Synuclein | Neuroscience | Neurodegeneration | Multiple System Atrophy
Swiss Prot P37840-1
Scientific Background Human alpha synuclein TNG mutant (HuTNG) is a triple mutant containing Ala53 mutated to the equivalent mouse residue Thr53, Ser87 mutated to the equivalent mouse residue Asn87, and Asn103 mutated to the equivalent mouse residue Gly103, effectively making it a human-mouse chimeric protein. Despite sequence differences at only seven residues, or 5% of the total 140 amino acids, the aggregation rate of wild-type mouse α-syn (MsWT) is faster than wild-type human α-syn (HuWT) in vitro. In wild-type mouse models, MsWT fibrils are more efficient than HuWT fibrils at inducing endogenous mouse α-syn pathology (1). A53T or S87N substitutions in human α-syn substantially accelerate fibrilization rates in vitro (2,3). Chimeric HuTNG fibrils show enhanced induction of α-syn pathology greater than both HuWT and MsWT fibrils after single unilateral injection into the dorsal striatum in mice (4). Therefore, HuTNG is a good construct for inducing robust endogenous α-syn seeding and pathology in wild-type mice.
Expression System E. coli
Protein Length Full length (1 - 140 aa)
Amino Acid Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQLGKGEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Purification Ion-exchange Purified
Storage -80ºC
References 1. Masuda-Suzukake et al. 2013. Prion-like Spreading of Pathological α-synuclein in Brain. Brain. https://doi.org/10.1093/brain/awt037 2. Kang, K. et al. 2011. The A53T Mutation is Key in Defining the Differences in the Aggregation Kinetics of Human and Mouse α-synuclein. JACS. https://doi.org/10.1021/ja203979j 3. Ohgita, T. et al. 2023. Intramolecular Interaction Kinetically Regulates Fibril Formation by Human and Mouse Alpha-Synuclein. Sci Rep https://doi.org/10.1038/s41598-023-38070-4 4. Luk, K., C. et al. 2016. Molecular and Biological Compatibility with Host Alpha-Synuclein Influences Fibril Pathogenicity. Cell Rep. https://doi.org/10.1016/j.celrep.2016.08.053
Product Url View Document
Note The product is for research use only
SVG
SVG

Subscribe to our newsletter

Drop your email address to get regular updates about discounts and offers