Alpha Synuclein Pre-formed Fibrils: Biotinylated (C-terminus)
SKU: BTL-SM-P-00273 |
Brand: Stressmarq
Product Description
| Cat Number | SPR-508XE |
|---|---|
| Category | Recombinant Protein |
| Pack Size | 500 µg (@5mg/ml) |
| Description | Human Recombinant Alpha Synuclein Pre-formed Fibrils: Biotinylated (C-terminus) |
| Applications | WB | SDS PAGE | In vitro Assay | In vivo Assay |
| Target | Alpha Synuclein Biotinylated (C-terminus) |
| Molecular Weight | 16.27 kDa |
| Purity | > 95% based on SDS-PAGE and nanodrop analysis. |
| Research Area | Neuroscience | Neurodegeneration | Alzheimer's Disease | Tangles & Tau | Neuroscience | Neurodegeneration | Parkinson's Disease | Synuclein | Neuroscience | Neurodegeneration | Multiple System Atrophy |
| Swiss Prot | P37840 |
| Scientific Background | A 15 amino acid tag on the C-terminal tail of Alpha Synuclein facilitates site-specific covalent biotinylation (1). Biotinylation of purified alpha synuclein allows for many biological applications, such as monitoring and detection using streptavidin-based conjugates (1, 2, 3). Our biotinylated monomers are also used to generate pre-formed fibrils in-vitro. |
| Expression System | E. coli |
| Protein Length | 155 aa |
| Amino Acid Sequence | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVH GVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL GKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEAGLNDIFEAQK IEWHE |
| Purification | Ion-exchange Purified |
| Storage | -80ºC |
| References | 1. Fairhead & Howarth. 2015. Site-specific biotinylation of purified proteins using BirA. Methods in Molecular Biology. DOI: 1007/978-1-4939-2272-7_12 2. Hallacli et al. 2022. The Parkinson’s disease protein alpha synuclein is a modulator of Processing-bodies and mRNA stability. Cell. DOI: 10.1016/j.cell.2022.05.008 3. Li et al. 2019. Naturally occurring antibodies isolated from PD patients inhibit synuclein seeding in vitro and recognize Lewy pathology. Acta neuropathologica. DOI: 10.1007/s00401-019-01974-5. |
| Product Url | View Document |
| Note | The product is for research use only |

Share Item: