Your Cart
Product
Product Title

2 x $5566
Total:$11132.00
Proceed to Checkout
SVG
SVG

Search Products from 10 Million+

SVG

Tau-383 (0N4R) Wild-Type Monomers

SKU: BTL-SM-P-00276 | Brand: Stressmarq
Quick Enquiry

Product Description

Cat Number SPR-509E
Category Recombinant Protein
Pack Size 100 µg x5
Description Human Recombinant Tau-383 (0N4R) Wild-Type Monomers
Applications WB | SDS PAGE | In vitro Assay
Target Tau-383 (0N4R)
Molecular Weight 40.007 kDa
Purity >95%
Research Area Neuroscience | Neurodegeneration | Alzheimer's Disease | Tangles & Tau
Swiss Prot P10636-6
Scientific Background Several tau isoforms, including 0N4R, are expressed in the human brain, and the existence of multiple human tauopathies with distinct fibril morphologies suggests different molecular conformers incorporating different isoforms may exist (1, 2). NMR data indicates that both 3R and 4R tau are incorporated into AD-tau seeded fibrils (3).
Expression System E. coli
Protein Length 383 aa
Amino Acid Sequence MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
Purification Ion-exchange Purified
Storage -80ºC
References 1. Goedert et al. 1989. Multiple isoforms of human microtubule-associated protein tau: sequences and localization in neurofibrillary tangles of Alzheimer’s disease. Neuron. DOI: 10.1016/0896-6273(89)90210-9 2. Goedert, Eisenberg and Crowther. 2017. Propagation of Tau Aggregates and Neurodegeneration. Annual Review of Neuroscience. DOI: 10.1146/annurev-neuro-072116-031153 3. Dregni et al. 2022. Fluent molecular mixing of Tau isoforms in Alzheimer’s disease neurofibrillary tangles. Nature communications. DOI: 10.1038/s41467-022-30585-0
Product Url View Document
Note The product is for research use only
SVG
SVG

Subscribe to our newsletter

Drop your email address to get regular updates about discounts and offers