Product Description
| Cat Number | TP-010 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Cell permeable TRPM2 antagonist |
| Modification | None |
| Purity | >95% by hplc |
| Biomarker Target | Transient receptor potential (TRP) channels |
| Sequence Three Letter Code | H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Ser-Arg-Glu-Pro-Gly-Glu-Met-Leu-Pro-Arg-Lys-Leu-Lys-Arg-Val-Leu-Arg-Gln-Glu-Phe-Trp-Val-OH |
| Molecular Formula | C190H323N71O45 S |
| Sl Sequence | YGRKKRRQRRRGSREPGEMLPRKLKRVLRQEFWV |
| Solubility | Soluble in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| References |
Shimizu et al (2016) Extended therapeutic window of a novel peptide inhibitor of TRPM2 channels following focal cerebral ischemia. Exp Neurol. 283(Pt A) 151 PMID: 27317297Cruz-Torres et al (2020) Characterization and Optimization of the Novel Transient Receptor Potential Melastatin 2 Antagonist tatM2NX. Mol Pharmacol. 97(2) 102 PMID: 31772034 Related dataAll cell penetrating peptides >All transient receptor potential channel modulators >All neuroscience categories > |
| Note | The product is for research use only |
Share Item: