Your Cart
Product
Product Title

2 x $5566
Total:$11132.00
Proceed to Checkout
SVG
SVG

Search Products from 10 Million+

SVG

LL 37 (human)

SKU: BTL-IB-P-00190 | Brand: Isca Biochemical
Quick Enquiry

Product Description

Cat Number AM-001
Category Peptide
Pack Size 1 mg
Description Host defence peptide derived from the C-terminal of human cathelicidin antimicrobial peptide
Modification None
Purity >95% by HPLC
Biomarker Target Antibacterials,Antivirals
Sequence Three Letter Code H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
Molecular Formula C205H340N60O53
Sl Sequence [LL-37, 37 aa]
Solubility Soluble in physiological buffers including PBS (>1mg/mL). Soluble in DMSO as a stock
Appearance Freeze dried solid
Storage Store dry, dark and frozen
References Kahlenberg and Kaplan (2013) Little peptide, big effects: the role of LL-37 in inflammation and autoimmune disease. J. Immunol. 191(10) 4895 PMID: 24185823Bandurska et al (2015) Unique features of human cathelicidin LL€37. BioFactors 41 289 PMID: 26434733Chen et al (2018) Roles and Mechanisms of Human Cathelicidin LL-37 in Cancer. Cell Physiol.Biochem. 47 1060 PMID: 29843147Vierthaler et al (2020) Fluctuating role of antimicrobial peptide hCAP18/LL€‘37 in oral tongue dysplasia and carcinoma. Oncol. Rep. 44 325 PMID: 32627035Guide to Pharmacology - LL 37
Related areas_x000D_
All antimicrobial peptides >All antiviral agents >All immunology research categories >All cancer research categories >All neuroscience research categories >
Note The product is for research use only
SVG
SVG

Subscribe to our newsletter

Drop your email address to get regular updates about discounts and offers