Product Description
| Cat Number | AM-002 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Scrambled control peptide for LL-37 |
| Modification | None |
| Purity | >95% by HPLC |
| Biomarker Target | Antibacterials |
| Sequence Three Letter Code | H-Gly-Leu-Lys-Leu-Arg-Phe-Glu-Phe-Ser-Lys-Ile-Lys-Gly-Glu-Phe-Leu-Lys-Thr-Pro-Glu-Val-Arg-Phe-Arg-Asp-Ile-Lys-Leu-Lys-Asp-Asn-Arg-Ile-Ser-Val-Gln-Arg-OH |
| Molecular Formula | C205H340N60O53 |
| Sl Sequence | GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store dry, dark and frozen |
| References |
Kahlenberg and Kaplan (2013) Little peptide, big effects: the role of LL-37 in inflammation and autoimmune disease. J. Immunol. 191(10) 4895 PMID: 24185823Bandurska et al (2015) Unique features of human cathelicidin LL€37. BioFactors 41 289 PMID: 26434733Chen et al (2018) Roles and Mechanisms of Human Cathelicidin LL-37 in Cancer. Cell Physiol.Biochem. 47 1060 PMID: 29843147 Related areasAll antimicrobial peptides >All immunology research areas > |
| Note | The product is for research use only |
Share Item: