Product Description
| Cat Number | AM-003 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | N-terminally biotinylated version of the host defence peptide LL 37 |
| Modification | Biotin attched to the N terminal via a 6-aminohexanoic acid linker |
| Purity | >95% by HPLC |
| Biomarker Target | Antibacterials |
| Sequence Three Letter Code | Biotin-Ahx- Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH |
| Molecular Formula | C221H366N64O55S |
| Sl Sequence | Biotin-Ahx[LL-37, 37 aa] |
| Solubility | Soluble in water |
| Appearance | Freeze dried solid |
| Storage | Store dark, frozen and desiccated. |
| References |
Nuding et al (2013) Gastric Antimicrobial Peptides Fail to Eradicate Helicobacter pylori Infection Due to Selective Induction and Resistance. PLoS ONE 8(9) e73867 PMID: 24040100 Related areasAll biotin labelled peptides >All antimicrobial peptides > |
| Note | The product is for research use only |
Share Item: