Product Description
| Cat Number | AM-004 |
|---|---|
| Category | Peptide |
| Pack Size | 0.1 mg |
| Description | N-terminally carboxyfluoresceinated derivative of the host defence peptide LL 37 |
| Modification | 5-FAM is attached to the N teminal via a 6-aminohexanoic acid linker |
| Purity | >95% by HPLC |
| Biomarker Target | Antibacterials |
| Sequence Three Letter Code | 5-FAM-Ahx-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH |
| Molecular Formula | C226H351N61O58 |
| Sl Sequence | 5FAM-Ahx[LL-37, 37 aa] |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store dark, frozen and desiccated |
| References |
Kahlenberg and Kaplan (2013) Little peptide, big effects: the role of LL-37 in inflammation and autoimmune disease. J. Immunol. 191(10) 4895 PMID: 24185823Bandurska et al (2015) Unique features of human cathelicidin LL€37. BioFactors 41 289 PMID: 26434733Chen et al (2018) Roles and Mechanisms of Human Cathelicidin LL-37 in Cancer. Cell Physiol.Biochem. 47 1060 PMID: 29843147 Related areasAll fluorescent labelled peptides >All antimicrobial peptides > |
| Note | The product is for research use only |
Share Item: