Product Description
| Cat Number | AM-390 |
|---|---|
| Category | Peptide |
| Pack Size | 1 mg |
| Description | Fungal cytolytic peptide toxin from Candida albicans |
| Modification | None |
| Purity | >95% by hplc |
| Biomarker Target | Antifungals |
| Sequence Three Letter Code | H-Ser-Ile-Ile-Gly-Ile-Ile-Met-Gly-Ile-Leu-Gly-Asn-Ile-Pro-Gln-Val-Ile-Gln-Ile-Ile-Met-Ser-Ile-Val-Lys-Ala-Phe-Lys-Gly-Asn-Lys-OH |
| Molecular Formula | C153H266N38O38S2 |
| Sl Sequence | SIIGIIMGILGNIPQVIQIIMSIVKAFKGNK |
| Solubility | Soluble in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| References |
Moyes et al (2016) Candidalysin is a fungal peptide toxin critical for mucosal infection. Nature 532(7597) 64 PMID: 27027296Naglik et al (2019) Candidalysin: discovery and function in Candida albicans infections. Curr Opin Microbiol. 52 100 PMID: 31288097Hu et al (2023) Candidalysin amplifies the immune inflammatory response in Candida albicans keratitis through the TREM-1/DAP12 pathway. Int Immunopharmacol. 119 110195 PMID: 37087869 Related areasAll peptides >All fungal agents >All immunology research categories > |
| Note | The product is for research use only |
Share Item: