Product Title

2 x $5566

Total:$11132.00

Back to shop

Proceed to Checkout

SVG

SVG

Search Products from 10 Million+

SVG

Apelin 36 (human)

SKU: BTL-IB-P-00048 | Brand: Isca Biochemical

Quick Enquiry

Product Description

Cat Number	AR-010
Category	Peptide
Pack Size	1 mg
Description	Endogenous apelin agonist
Modification	None
Purity	>95% by hplc
Biomarker Target	Apelin receptors
Sequence Three Letter Code	H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH
Molecular Formula	C184H297N69O43S
Sl Sequence	LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
Solubility	Soluble to 1 mg/ml in water
Appearance	Freeze dried solid
Storage	Store dry, frozen and in the dark
References	Tatemoto et al (1998) Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor. Biochem.Biophys.Res.Comm. 251 471 PMID: 9792798Medhurst et al (2003) Pharmacological and immunohistochemical characterization of the APJ receptor and its endogenous ligand apelin. J Neurochem. 84(5) 1162 PMID: 12603839Galon-Tilleman et al (2017) Apelin-36 Modulates Blood Glucose and Body Weight Independently of Canonical APJ Receptor Signaling. J Biol Chem. 292(5):1925 PMID: 27994053 Related areas_x000D_ All peptides >All apelin receptor modulators >All cardiovascular research categories >All appetite regulation research categories >
Note	The product is for research use only

SVG

SVG

Subscribe to our newsletter

Drop your email address to get regular updates about discounts and offers