Product Title

2 x $5566

Total:$11132.00

Back to shop

Proceed to Checkout

SVG

SVG

Search Products from 10 Million+

SVG

CRF (human, rat)

SKU: BTL-IB-P-00093 | Brand: Isca Biochemical

Quick Enquiry

Product Description

Cat Number	CR-020
Category	Peptide
Pack Size	1 mg
Description	Endogenous CRF receptor agonist
Modification	C-terminal amide
Purity	>95% by hplc
Biomarker Target	Corticotropin releasing factor receptors
Sequence Three Letter Code	H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2
Molecular Formula	C208H344N60O63S2
Sl Sequence	SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
Solubility	Soluble to 1.10 mg/ml in water
Appearance	Freeze dried solid
Storage	Store dry, frozen and in the dark
References	Vale et al (1981) Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and beta-endorphin. Science. 213(4514) 1394 PMID: 6267699Ohmura and Yoshioka (2008) The roles of corticotropin releasing factor (CRF) in responses to emotional stress: is CRF release a cause or result of fear/anxiety? CNS Neurol Disord Drug Targets. 8(6) 459 PMID: 19811447Jiang et al (2019) Role of Corticotropin Releasing Factor in the Neuroimmune Mechanisms of Depression: Examination of Current Pharmaceutical and Herbal Therapies. Front Cell Neurosci. 13 290 PMID: 31312123 Related areas All peptides >All corticotropin releasing factor receptor modulators >All endocrinology categories >All neuroscience categories >
Note	The product is for research use only

SVG

SVG

Subscribe to our newsletter

Drop your email address to get regular updates about discounts and offers